SCOPe 2.08: Domain d2g1aa_: 2g1a A:

Lineage for d2g1aa_ (2g1a A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin
   automatically mapped to Pfam PF03767

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (13 PDB entries)
   Uniprot P32697 27-237

8. Domain d2g1aa_: 2g1a A: [134514]
   automated match to d1rm7a_
   complexed with 5hg, mg

Details for d2g1aa_

PDB Entry: 2g1a, 2 Å

PDB Description: Crystal structure of the complex between Apha class B acid phosphatase/phosphotransferase

PDB Compounds: (A:) Class B acid phosphatase

SCOPe Domain Sequences for d2g1aa_:

Sequence; same for both SEQRES and ATOM records:

>d2g1aa_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

Timeline for d2g1aa_:

• d2g1aa_ first appeared in SCOP 1.73, called d2g1aa1
  
• d2g1aa_ appears in SCOPe 2.07