PDB entry 2g1a

View 2g1a on RCSB PDB site
Description: Crystal structure of the complex between Apha class B acid phosphatase/phosphotransferase
Class: hydrolase
Keywords: hydrolase; acid phosphatase/phosphotransferase; metallo phosphatase, hydrolase
Deposited on 2006-02-14, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g1aa_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g1ab_
  • Heterogens: MG, 5HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g1aA (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1aA (A:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g1aB (B:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g1aB (B:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey