SCOPe 2.07: Domain d2fzkd1: 2fzk D:2-100

Lineage for d2fzkd1 (2fzk D:2-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
   Uniprot P00478

8. Domain d2fzkd1: 2fzk D:2-100 [134455]
   Other proteins in same PDB: d2fzka1, d2fzka2, d2fzkb2, d2fzkc1, d2fzkc2, d2fzkd2
   automated match to d1d09b1
   complexed with ctp, eoz, zn

Details for d2fzkd1

PDB Entry: 2fzk, 2.5 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2fzkd1:

Sequence; same for both SEQRES and ATOM records:

>d2fzkd1 d.58.2.1 (D:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
entflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d2fzkd1:

• d2fzkd1 first appeared in SCOP 1.73
  
• d2fzkd1 appears in SCOPe 2.06
  
• d2fzkd1 appears in the current release, SCOPe 2.08