Lineage for d2fzkd1 (2fzk D:2-100)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650481Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1650482Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1650483Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1650484Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 1650585Domain d2fzkd1: 2fzk D:2-100 [134455]
    Other proteins in same PDB: d2fzka1, d2fzka2, d2fzkb2, d2fzkc1, d2fzkc2, d2fzkd2
    automated match to d1d09b1
    complexed with ctp, eoz, zn

Details for d2fzkd1

PDB Entry: 2fzk (more details), 2.5 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.50 Resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2fzkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzkd1 d.58.2.1 (D:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
entflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d2fzkd1:

Click to download the PDB-style file with coordinates for d2fzkd1.
(The format of our PDB-style files is described here.)

Timeline for d2fzkd1: