Lineage for d2fyta1 (2fyt A:238-548)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892989Protein Protein arginine N-methyltransferase 3, PRMT3 [142581] (1 species)
  7. 2892990Species Human (Homo sapiens) [TaxId:9606] [142582] (5 PDB entries)
    Uniprot O60678 221-531
  8. 2892992Domain d2fyta1: 2fyt A:238-548 [134391]
    complexed with sah

Details for d2fyta1

PDB Entry: 2fyt (more details), 2 Å

PDB Description: Human HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae) protein
PDB Compounds: (A:) Protein arginine N-methyltransferase 3

SCOPe Domain Sequences for d2fyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}
fssyghygiheemlkdkirtesyrdfiyqnphifkdkvvldvgcgtgilsmfaakagakk
vlgvdqseilyqamdiirlnkledtitlikgkieevhlpvekvdviisewmgyfllfesm
ldsvlyaknkylakggsvypdictislvavsdvnkhadriafwddvygfkmscmkkavip
eavvevldpktlisepcgikhidchttsisdlefssdftlkitrtsmctaiagyfdiyfe
knchnrvvfstgpqstkthwkqtvfllekpfsvkagealkgkvtvhknkkdprsltvtlt
lnnstqtyglq

SCOPe Domain Coordinates for d2fyta1:

Click to download the PDB-style file with coordinates for d2fyta1.
(The format of our PDB-style files is described here.)

Timeline for d2fyta1: