Lineage for d2fymd2 (2fym D:1-139)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025940Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1025941Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1025942Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1025985Protein Enolase [54828] (8 species)
  7. 1026017Species Escherichia coli [TaxId:562] [69710] (2 PDB entries)
  8. 1026020Domain d2fymd2: 2fym D:1-139 [134384]
    Other proteins in same PDB: d2fyma1, d2fymc1, d2fymd1, d2fymf1
    automatically matched to d1e9ia2
    protein/RNA complex; complexed with mg

Details for d2fymd2

PDB Entry: 2fym (more details), 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d2fymd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fymd2 d.54.1.1 (D:1-139) Enolase {Escherichia coli [TaxId: 562]}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

SCOPe Domain Coordinates for d2fymd2:

Click to download the PDB-style file with coordinates for d2fymd2.
(The format of our PDB-style files is described here.)

Timeline for d2fymd2: