SCOPe 2.01: Domain d2fy8a1: 2fy8 A:116-244

Lineage for d2fy8a1 (2fy8 A:116-244)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)

6. Protein Potassium channel-related protein MthK [75122] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (2 PDB entries)

8. Domain d2fy8a1: 2fy8 A:116-244 [134345]
   Other proteins in same PDB: d2fy8a2, d2fy8b2, d2fy8c2, d2fy8d2, d2fy8e2, d2fy8f2, d2fy8g2, d2fy8h2
   automatically matched to d1lnqa3

Details for d2fy8a1

PDB Entry: 2fy8, 2.79 Å

PDB Description: crystal structure of mthk rck domain in its ligand-free gating-ring form

PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2fy8a1:

Sequence; same for both SEQRES and ATOM records:

>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

Timeline for d2fy8a1:

• d2fy8a1 first appeared in SCOP 1.73
  
• d2fy8a1 appears in SCOP 1.75
  
• d2fy8a1 appears in SCOPe 2.02
  
• d2fy8a1 appears in the current release, SCOPe 2.08