SCOPe 2.04: Domain d2fxua1: 2fxu A:4-146

Lineage for d2fxua1 (2fxu A:4-146)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (61 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d2fxua1: 2fxu A:4-146 [134340]
   automated match to d1j6za1
   complexed with atp, bid, ca

Details for d2fxua1

PDB Entry: 2fxu, 1.35 Å

PDB Description: X-ray Structure of Bistramide A- Actin Complex at 1.35 A resolution.

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2fxua1:

Sequence, based on SEQRES records:

>d2fxua1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d2fxua1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvdsyvgdeaqskrgiltlkyp
iehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvp
amyvaiqavlslyasg

Timeline for d2fxua1:

• d2fxua1 first appeared in SCOP 1.73
  
• d2fxua1 appears in SCOPe 2.03
  
• d2fxua1 appears in SCOPe 2.05
  
• d2fxua1 appears in the current release, SCOPe 2.08