SCOP 1.75: Domain d2fx7l1: 2fx7 L:1-107

Lineage for d2fx7l1 (2fx7 L:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)

8. Domain d2fx7l1: 2fx7 L:1-107 [134278]
   Other proteins in same PDB: d2fx7h1, d2fx7h2, d2fx7l2
   automatically matched to d1rhha1
   complexed with gol; mutant

Details for d2fx7l1

PDB Entry: 2fx7, 1.76 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a 16-residue peptide encompassing the 4e10 epitope on gp41

PDB Compounds: (L:) Fab 4E10

SCOP Domain Sequences for d2fx7l1:

Sequence; same for both SEQRES and ATOM records:

>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk

Timeline for d2fx7l1:

• d2fx7l1 first appeared in SCOP 1.73
  
• d2fx7l1 appears in SCOPe 2.01
  
• d2fx7l1 appears in the current release, SCOPe 2.08