Lineage for d2fwrd2 (2fwr D:23-256)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989960Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 989987Protein DNA repair protein RAD25 [142318] (1 species)
    shares with the DNA helicase UvsW (102396) extra N-terminal alpha+beta subdomain that might be related to the DNA repair protein MutS domain I (55271)
  7. 989988Species Archaeoglobus fulgidus [TaxId:2234] [142319] (3 PDB entries)
    Uniprot O29889 237-436! Uniprot O29889 238-434! Uniprot O29889 3-236! Uniprot O29889 4-209
  8. 989997Domain d2fwrd2: 2fwr D:23-256 [134260]
    automatically matched to 2FWR A:23-256
    complexed with ipa, po4

Details for d2fwrd2

PDB Entry: 2fwr (more details), 2.6 Å

PDB Description: structure of archaeoglobus fulgidis xpb
PDB Compounds: (D:) DNA repair protein RAD25

SCOPe Domain Sequences for d2fwrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwrd2 c.37.1.19 (D:23-256) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}
miaeiyyergtivvkgdahvphakfdsrsgtyralafryrdiieyfesngiefvdnaadp
iptpyfdaeislrdyqekalerwlvdkrgcivlptgsgkthvamaainelstptlivvpt
lalaeqwkerlgifgeeyvgefsgrikelkpltvstydsayvnaeklgnrfmllifdevh
hlpaesyvqiaqmsiapfrlgltatferedgrheilkevvggkvfelfpdslag

SCOPe Domain Coordinates for d2fwrd2:

Click to download the PDB-style file with coordinates for d2fwrd2.
(The format of our PDB-style files is described here.)

Timeline for d2fwrd2: