![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
![]() | Protein Ribokinase [53615] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142709] (11 PDB entries) Uniprot Q9H477 15-322 |
![]() | Domain d2fv7a1: 2fv7 A:15-322 [134197] complexed with adp, mg, na, unx |
PDB Entry: 2fv7 (more details), 2.1 Å
SCOPe Domain Sequences for d2fv7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} vaavvvvgscmtdlvsltsrlpktgetihghkffigfggkganqcvqaarlgamtsmvck vgkdsfgndyienlkqndisteftyqtkdaatgtasiivnnegqniivivaganlllnte dlraaanvisrakvmvcqleitpatslealtmarrsgvktlfnpapaiadldpqfytlsd vfccneseaeiltgltvgsaadageaalvllkrgcqvviitlgaegcvvlsqtepepkhi ptekvkavdttgagdsfvgalafylayypnlsledmlnrsnfiaavsvqaagtqssypyk kdlpltlf
Timeline for d2fv7a1: