Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) |
Family c.57.1.1: MogA-like [53219] (5 proteins) |
Protein MogA [53220] (2 species) |
Species Shewanella oneidensis [TaxId:70863] [142541] (3 PDB entries) |
Domain d2fuwf1: 2fuw F:3-173 [134192] automatically matched to 2F7W A:2-174 |
PDB Entry: 2fuw (more details), 1.9 Å
SCOP Domain Sequences for d2fuwf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fuwf1 c.57.1.1 (F:3-173) MogA {Shewanella oneidensis [TaxId: 70863]} kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr
Timeline for d2fuwf1: