PDB entry 2fuw

View 2fuw on RCSB PDB site
Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
Class: structural genomics, unknown function
Keywords: Structural Genomics, Molybdenum cofactor biosynthesis protein Mog , PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-01-27, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Shewanella oneidensis
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EKM7
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2fuwa1
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Shewanella oneidensis
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EKM7
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2fuwb1
  • Chain 'C':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Shewanella oneidensis
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EKM7
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2fuwc1
  • Chain 'D':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Shewanella oneidensis
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EKM7
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2fuwd1
  • Chain 'E':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Shewanella oneidensis
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EKM7
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2fuwe1
  • Chain 'F':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Shewanella oneidensis
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EKM7
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2fuwf1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fuwA (A:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fuwA (A:)
    kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
    deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
    lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fuwB (B:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fuwB (B:)
    kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
    deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
    lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fuwC (C:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fuwC (C:)
    kakigivtvsdragiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmade
    qdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtaglr
    gdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fuwD (D:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fuwD (D:)
    kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
    deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
    lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fuwE (E:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fuwE (E:)
    kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
    deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
    lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fuwF (F:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fuwF (F:)
    kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
    deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
    lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr