Lineage for d2ftkd1 (2ftk D:612-792)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732764Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)
  4. 732765Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) (S)
    Histidine kinase-like fold lacking the kinase ATP-binding site
  5. 732766Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)
  6. 732767Protein Sporulation response regulatory protein Spo0B [55892] (1 species)
  7. 732768Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)
  8. 732774Domain d2ftkd1: 2ftk D:612-792 [134068]
    Other proteins in same PDB: d2ftke1, d2ftkf1, d2ftkg1, d2ftkh1
    automatically matched to d1f51b_
    complexed with bfd, mg; mutant

Details for d2ftkd1

PDB Entry: 2ftk (more details), 3.05 Å

PDB Description: berylloflouride spo0f complex with spo0b
PDB Compounds: (D:) sporulation initiation phosphotransferase b

SCOP Domain Sequences for d2ftkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftkd1 d.123.1.1 (D:612-792) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
d

SCOP Domain Coordinates for d2ftkd1:

Click to download the PDB-style file with coordinates for d2ftkd1.
(The format of our PDB-style files is described here.)

Timeline for d2ftkd1: