![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily) core: alpha-beta-alpha-beta(2)-(alpha)-beta(2) |
![]() | Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) ![]() Histidine kinase-like fold lacking the kinase ATP-binding site |
![]() | Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein) |
![]() | Protein Sporulation response regulatory protein Spo0B [55892] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries) |
![]() | Domain d2ftkc1: 2ftk C:412-592 [134067] Other proteins in same PDB: d2ftke1, d2ftkf1, d2ftkg1, d2ftkh1 automatically matched to d1f51b_ complexed with bfd, mg; mutant |
PDB Entry: 2ftk (more details), 3.05 Å
SCOP Domain Sequences for d2ftkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftkc1 d.123.1.1 (C:412-592) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl d
Timeline for d2ftkc1: