SCOPe 2.04: Domain d2ftkb_: 2ftk B:

Lineage for d2ftkb_ (2ftk B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
   core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)

4. Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family)
   Histidine kinase-like fold lacking the kinase ATP-binding site

5. Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)

6. Protein Sporulation response regulatory protein Spo0B [55892] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)

8. Domain d2ftkb_: 2ftk B: [134066]
   Other proteins in same PDB: d2ftke_, d2ftkf_, d2ftkg_, d2ftkh_
   automated match to d1ixmb_
   complexed with mg

Details for d2ftkb_

PDB Entry: 2ftk, 3.05 Å

PDB Description: berylloflouride spo0f complex with spo0b

PDB Compounds: (B:) sporulation initiation phosphotransferase b

SCOPe Domain Sequences for d2ftkb_:

Sequence; same for both SEQRES and ATOM records:

>d2ftkb_ d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
ld

Timeline for d2ftkb_:

• d2ftkb_ first appeared in SCOP 1.73, called d2ftkb1
  
• d2ftkb_ was called d2ftkb1 in SCOPe 2.03
  
• d2ftkb_ appears in SCOPe 2.05
  
• d2ftkb_ appears in the current release, SCOPe 2.08