Lineage for d2ftka_ (2ftk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925253Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)
  4. 1925254Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) (S)
    Histidine kinase-like fold lacking the kinase ATP-binding site
  5. 1925255Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)
  6. 1925256Protein Sporulation response regulatory protein Spo0B [55892] (1 species)
  7. 1925257Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)
  8. 1925260Domain d2ftka_: 2ftk A: [134065]
    Other proteins in same PDB: d2ftke_, d2ftkf_, d2ftkg_, d2ftkh_
    automated match to d1ixmb_
    complexed with mg

Details for d2ftka_

PDB Entry: 2ftk (more details), 3.05 Å

PDB Description: berylloflouride spo0f complex with spo0b
PDB Compounds: (A:) sporulation initiation phosphotransferase b

SCOPe Domain Sequences for d2ftka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftka_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
d

SCOPe Domain Coordinates for d2ftka_:

Click to download the PDB-style file with coordinates for d2ftka_.
(The format of our PDB-style files is described here.)

Timeline for d2ftka_: