Lineage for d1ixmb_ (1ixm B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) 
Histidine kinase-like fold lacking the kinase ATP-binding siteFamily d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein) Protein Sporulation response regulatory protein Spo0B [55892] (1 species) Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries) 
Domain d1ixmb_: 1ixm B: [41115]
Details for d1ixmb_
PDB Entry: 1ixm (more details), 2.6 Å
PDB Description: crystal structure of spoob from bacillus subtilis
PDB Compounds: (B:) protein (sporulation response regulatory protein)SCOPe Domain Sequences for d1ixmb_:
Sequence, based on SEQRES records: (download)
>d1ixmb_ d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
ld
Sequence, based on observed residues (ATOM records): (download)
>d1ixmb_ d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddivdimrfeitsheclieigld
SCOPe Domain Coordinates for d1ixmb_:
Click to download the PDB-style file with coordinates for d1ixmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ixmb_:
- d1ixmb_ first appeared (with stable ids) in SCOP 1.55
- d1ixmb_ appears in SCOPe 2.04
- d1ixmb_ appears in SCOPe 2.06
- d1ixmb_ appears in the current release, SCOPe 2.08
View in 3D
