Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein Phenylacetic acid degradation protein PaaI [89903] (2 species) |
Species Escherichia coli [TaxId:562] [89904] (2 PDB entries) |
Domain d2fs2b2: 2fs2 B:2-137 [134004] Other proteins in same PDB: d2fs2a2, d2fs2b3 automated match to d1psua_ complexed with so4 |
PDB Entry: 2fs2 (more details), 2 Å
SCOPe Domain Sequences for d2fs2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fs2b2 d.38.1.5 (B:2-137) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} shkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfslad tafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqkt valfrgkshriggtit
Timeline for d2fs2b2: