Lineage for d2fs2b2 (2fs2 B:2-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943942Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 2943943Species Escherichia coli [TaxId:562] [89904] (2 PDB entries)
  8. 2943945Domain d2fs2b2: 2fs2 B:2-137 [134004]
    Other proteins in same PDB: d2fs2a2, d2fs2b3
    automated match to d1psua_
    complexed with so4

Details for d2fs2b2

PDB Entry: 2fs2 (more details), 2 Å

PDB Description: structure of the e. coli paai protein from the phyenylacetic acid degradation operon
PDB Compounds: (B:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d2fs2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fs2b2 d.38.1.5 (B:2-137) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]}
shkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfslad
tafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqkt
valfrgkshriggtit

SCOPe Domain Coordinates for d2fs2b2:

Click to download the PDB-style file with coordinates for d2fs2b2.
(The format of our PDB-style files is described here.)

Timeline for d2fs2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fs2b3