SCOPe 2.08: Domain d2foea_: 2foe A:

Lineage for d2foea_ (2foe A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d2foea_: 2foe A: [133879]
   automated match to d1b0ea_
   complexed with 217, ca, so4

Details for d2foea_

PDB Entry: 2foe, 2.2 Å

PDB Description: structure of porcine pancreatic elastase in 80% hexane

PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2foea_:

Sequence; same for both SEQRES and ATOM records:

>d2foea_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2foea_:

• d2foea_ first appeared in SCOP 1.73, called d2foea1
  
• d2foea_ appears in SCOPe 2.07