Lineage for d2fnjb1 (2fnj B:1-98)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931398Species Mouse (Mus musculus) [TaxId:10090] [142930] (1 PDB entry)
    Uniprot P62869 1-98
  8. 2931399Domain d2fnjb1: 2fnj B:1-98 [133819]
    Other proteins in same PDB: d2fnja1, d2fnjc_

Details for d2fnjb1

PDB Entry: 2fnj (more details), 1.8 Å

PDB Description: crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c
PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d2fnjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnjb1 d.15.1.1 (B:1-98) Elongin B {Mouse (Mus musculus) [TaxId: 10090]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealriepfssppe

SCOPe Domain Coordinates for d2fnjb1:

Click to download the PDB-style file with coordinates for d2fnjb1.
(The format of our PDB-style files is described here.)

Timeline for d2fnjb1: