SCOPe 2.07: Domain d2fmlb2: 2fml B:4-204

Lineage for d2fmlb2 (2fml B:4-204)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins)
   accosiated with the C-terminal "winged helix" domain (46785)

6. Protein Hypothetical protein EF2700, N-terminal domain [143773] (1 species)
   includes extra N-terminal alpha-hairpin, separated by a linker peptide

7. Species Enterococcus faecalis [TaxId:1351] [143774] (1 PDB entry)
   Uniprot Q830S2 3-204

8. Domain d2fmlb2: 2fml B:4-204 [133781]
   Other proteins in same PDB: d2fmla1, d2fmlb1
   automated match to d2fmla2
   complexed with gol

Details for d2fmlb2

PDB Entry: 2fml, 2.26 Å

PDB Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis

PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d2fmlb2:

Sequence, based on SEQRES records:

>d2fmlb2 d.113.1.6 (B:4-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
faskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvlliqr
kghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgwv
vtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtla
fdhseiiikafnrvvdkmehe

Sequence, based on observed residues (ATOM records):

>d2fmlb2 d.113.1.6 (B:4-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
faskaeeknyyerqaslaefltwyhqqyekpsltvdmvllcynkeadqlkvlliqrkghp
frnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgwvvtvs
ylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtlafdhs
eiiikafnrvvdkmehe

Timeline for d2fmlb2:

• d2fmlb2 first appeared in SCOP 1.73
  
• d2fmlb2 appears in SCOPe 2.06
  
• d2fmlb2 appears in the current release, SCOPe 2.08