Lineage for d2flpa1 (2flp A:300-414)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240610Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2240611Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2240612Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 2240680Protein DNA polymerase iota [111015] (1 species)
  7. 2240681Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
    Uniprot Q9UNA4
  8. 2240694Domain d2flpa1: 2flp A:300-414 [133745]
    Other proteins in same PDB: d2flpa2
    protein/DNA complex

Details for d2flpa1

PDB Entry: 2flp (more details), 2.4 Å

PDB Description: Binary complex of the catalytic core of human DNA polymerase iota with DNA (template G)
PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d2flpa1:

Sequence, based on SEQRES records: (download)

>d2flpa1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records): (download)

>d2flpa1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryygresrqcpi
pshviqvmtpmvdilmklfrnmtllsvcfcnlk

SCOPe Domain Coordinates for d2flpa1:

Click to download the PDB-style file with coordinates for d2flpa1.
(The format of our PDB-style files is described here.)

Timeline for d2flpa1: