Lineage for d2flla2 (2fll A:27-299)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1234135Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1234136Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1235018Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1235107Protein DNA polymerase iota [111295] (1 species)
  7. 1235108Species Human (Homo sapiens) [TaxId:9606] [111296] (8 PDB entries)
    Uniprot Q9UNA4
  8. 1235116Domain d2flla2: 2fll A:27-299 [133728]
    Other proteins in same PDB: d2flla1
    automatically matched to d1t3na2
    protein/DNA complex; complexed with mg, ttp

Details for d2flla2

PDB Entry: 2fll (more details), 2.6 Å

PDB Description: Ternary complex of human DNA polymerase iota with DNA and dTTP
PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d2flla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flla2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
kilekelgisvaqriqklsfgednspvilsgpp

SCOPe Domain Coordinates for d2flla2:

Click to download the PDB-style file with coordinates for d2flla2.
(The format of our PDB-style files is described here.)

Timeline for d2flla2: