Lineage for d2flka_ (2flk A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586638Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1586649Protein CheY protein [52174] (5 species)
  7. 1586725Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)
  8. 1586732Domain d2flka_: 2flk A: [133726]
    automated match to d2che__
    complexed with cxs, so4

Details for d2flka_

PDB Entry: 2flk (more details), 2.1 Å

PDB Description: Crystal structure of CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5)
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2flka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flka_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d2flka_:

Click to download the PDB-style file with coordinates for d2flka_.
(The format of our PDB-style files is described here.)

Timeline for d2flka_: