Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries) |
Domain d2fkzf_: 2fkz F: [133693] automated match to d1bcfa_ complexed with fe2, hem, mg |
PDB Entry: 2fkz (more details), 2 Å
SCOPe Domain Sequences for d2fkzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkzf_ a.25.1.1 (F:) automated matches {Azotobacter vinelandii [TaxId: 354]} mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell edileseedhidwletqldlidkiglenylqsqmd
Timeline for d2fkzf_: