Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (1 family) |
Family f.3.1.1: Light-harvesting complex subunits [56919] (1 protein) |
Protein Light-harvesting complex subunits [56920] (5 species) |
Species Purple bacterium (Rhodoblastus acidophilus) [TaxId:1074] [56921] (3 PDB entries) |
Domain d2fkwe1: 2fkw E:1-53 [133671] automatically matched to d1nkza_ complexed with bcl, lda, rg1 |
PDB Entry: 2fkw (more details), 2.45 Å
SCOP Domain Sequences for d2fkwe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkwe1 f.3.1.1 (E:1-53) Light-harvesting complex subunits {Purple bacterium (Rhodoblastus acidophilus) [TaxId: 1074]} mnqgkiwtvvnpaigipallgsvtviailvhlailshttwfpaywqggvkkaa
Timeline for d2fkwe1: