Lineage for d2fkwe1 (2fkw E:1-53)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744638Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 744639Superfamily f.3.1: Light-harvesting complex subunits [56918] (1 family) (S)
  5. 744640Family f.3.1.1: Light-harvesting complex subunits [56919] (1 protein)
  6. 744641Protein Light-harvesting complex subunits [56920] (5 species)
  7. 744642Species Purple bacterium (Rhodoblastus acidophilus) [TaxId:1074] [56921] (3 PDB entries)
  8. 744653Domain d2fkwe1: 2fkw E:1-53 [133671]
    automatically matched to d1nkza_
    complexed with bcl, lda, rg1

Details for d2fkwe1

PDB Entry: 2fkw (more details), 2.45 Å

PDB Description: structure of lh2 from rps. acidophila crystallized in lipidic mesophases
PDB Compounds: (E:) Light-harvesting protein B-800/850, alpha chain

SCOP Domain Sequences for d2fkwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkwe1 f.3.1.1 (E:1-53) Light-harvesting complex subunits {Purple bacterium (Rhodoblastus acidophilus) [TaxId: 1074]}
mnqgkiwtvvnpaigipallgsvtviailvhlailshttwfpaywqggvkkaa

SCOP Domain Coordinates for d2fkwe1:

Click to download the PDB-style file with coordinates for d2fkwe1.
(The format of our PDB-style files is described here.)

Timeline for d2fkwe1: