Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries) |
Domain d2fkfa1: 2fkf A:9-154 [133653] Other proteins in same PDB: d2fkfa4 automatically matched to d1k2yx1 complexed with g16, zn |
PDB Entry: 2fkf (more details), 2 Å
SCOP Domain Sequences for d2fkfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkfa1 c.84.1.1 (A:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan eqiqalreriekndlasgvgsveqvd
Timeline for d2fkfa1: