PDB entry 2fkf

View 2fkf on RCSB PDB site
Description: Phosphomannomutase/Phosphoglucomutase from Pseudomonas aeruginosa with alpha-D-glucose 1,6-bisphosphate bound
Class: isomerase
Keywords: alpha/beta protein, phosphoserine, enzyme-metal complex, enzyme-ligand complex
Deposited on 2006-01-04, released 2006-04-04
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.253
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase/phosphoglucomutase
    Species: Pseudomonas aeruginosa
    Gene: AlgC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fkfa1, d2fkfa2, d2fkfa3, d2fkfa4
  • Heterogens: G16, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fkfA (A:)
    stakaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsg
    pelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivv
    agetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgn
    gvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglaf
    dgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrp
    vmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdse
    hvfsafpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvr
    asnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fkfA (A:)
    lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
    iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
    eqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvagvia
    pqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdgdrv
    gvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktgh
    slikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsafp
    sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv
    lvlrfeadteeeleriktvfrnqlkavdsslpvpf