Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry) |
Domain d2fk0i2: 2fk0 I:11-324 [133636] Other proteins in same PDB: d2fk0a1, d2fk0a2, d2fk0b1, d2fk0b2, d2fk0c3, d2fk0d2, d2fk0d3, d2fk0e3, d2fk0f2, d2fk0f3, d2fk0g3, d2fk0h2, d2fk0h3, d2fk0i3, d2fk0j2, d2fk0j3, d2fk0k3, d2fk0l2, d2fk0l3, d2fk0m3, d2fk0n2, d2fk0n3, d2fk0o3, d2fk0p2, d2fk0p3, d2fk0q3, d2fk0r2, d2fk0r3 automated match to d1jsma_ |
PDB Entry: 2fk0 (more details), 2.95 Å
SCOPe Domain Sequences for d2fk0i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk0i2 b.19.1.2 (I:11-324) automated matches {Influenza A virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d2fk0i2:
View in 3D Domains from other chains: (mouse over for more information) d2fk0a1, d2fk0a2, d2fk0b1, d2fk0b2, d2fk0c2, d2fk0c3, d2fk0d2, d2fk0d3, d2fk0e2, d2fk0e3, d2fk0f2, d2fk0f3, d2fk0g2, d2fk0g3, d2fk0h2, d2fk0h3, d2fk0j2, d2fk0j3, d2fk0k2, d2fk0k3, d2fk0l2, d2fk0l3, d2fk0m2, d2fk0m3, d2fk0n2, d2fk0n3, d2fk0o2, d2fk0o3, d2fk0p2, d2fk0p3, d2fk0q2, d2fk0q3, d2fk0r2, d2fk0r3 |