Lineage for d2fk0i2 (2fk0 I:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776100Species Influenza A virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry)
  8. 2776104Domain d2fk0i2: 2fk0 I:11-324 [133636]
    Other proteins in same PDB: d2fk0a1, d2fk0a2, d2fk0b1, d2fk0b2, d2fk0c3, d2fk0d2, d2fk0d3, d2fk0e3, d2fk0f2, d2fk0f3, d2fk0g3, d2fk0h2, d2fk0h3, d2fk0i3, d2fk0j2, d2fk0j3, d2fk0k3, d2fk0l2, d2fk0l3, d2fk0m3, d2fk0n2, d2fk0n3, d2fk0o3, d2fk0p2, d2fk0p3, d2fk0q3, d2fk0r2, d2fk0r3
    automated match to d1jsma_

Details for d2fk0i2

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d2fk0i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0i2 b.19.1.2 (I:11-324) automated matches {Influenza A virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0i2:

Click to download the PDB-style file with coordinates for d2fk0i2.
(The format of our PDB-style files is described here.)

Timeline for d2fk0i2: