Lineage for d2fiqd_ (2fiq D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086417Family c.1.10.7: GatZ-like [141837] (1 protein)
    Pfam PF08013
  6. 2086418Protein Putative tagatose 6-phosphate kinase 1 GatZ [141838] (1 species)
  7. 2086419Species Escherichia coli [TaxId:562] [141839] (1 PDB entry)
    Uniprot P37191 1-420
  8. 2086423Domain d2fiqd_: 2fiq D: [133530]
    automated match to d2fiqa1

Details for d2fiqd_

PDB Entry: 2fiq (more details), 2.25 Å

PDB Description: crystal structure of putative tagatose 6-phosphate kinase
PDB Compounds: (D:) putative tagatose 6-phosphate kinase 1

SCOPe Domain Sequences for d2fiqd_:

Sequence, based on SEQRES records: (download)

>d2fiqd_ c.1.10.7 (D:) Putative tagatose 6-phosphate kinase 1 GatZ {Escherichia coli [TaxId: 562]}
mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvpggeas
aiqsvhithvedaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqea
qalaqwientrmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieq
eliapenrsgclavieevmldepqywkkyyrtgfndslldiryslsdriryywphsrikn
svetmmvnlqgvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae

Sequence, based on observed residues (ATOM records): (download)

>d2fiqd_ c.1.10.7 (D:) Putative tagatose 6-phosphate kinase 1 GatZ {Escherichia coli [TaxId: 562]}
mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvhithve
daantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqeaqalaqwientr
mvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieqeliapenrsgc
lavieevmldepqywkkyyrtgfndslldiryslsdriryywphsriknsvetmmvnlqg
vdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae

SCOPe Domain Coordinates for d2fiqd_:

Click to download the PDB-style file with coordinates for d2fiqd_.
(The format of our PDB-style files is described here.)

Timeline for d2fiqd_: