PDB entry 2fiq

View 2fiq on RCSB PDB site
Description: Crystal structure of putative tagatose 6-phosphate kinase
Class: transferase
Keywords: structural genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-12-30, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative tagatose 6-phosphate kinase 1
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs2898
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37191 (0-419)
      • modified residue (0)
      • modified residue (58)
      • modified residue (102)
      • modified residue (126)
      • modified residue (251)
      • modified residue (318)
      • modified residue (364-365)
      • modified residue (377)
      • modified residue (403)
    Domains in SCOPe 2.07: d2fiqa1
  • Chain 'B':
    Compound: putative tagatose 6-phosphate kinase 1
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs2898
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37191 (0-End)
      • modified residue (0)
      • modified residue (58)
      • modified residue (102)
      • modified residue (126)
      • modified residue (251)
      • modified residue (318)
      • modified residue (364-365)
      • modified residue (377)
      • modified residue (403)
    Domains in SCOPe 2.07: d2fiqb_
  • Chain 'C':
    Compound: putative tagatose 6-phosphate kinase 1
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs2898
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37191 (0-End)
      • modified residue (0)
      • modified residue (58)
      • modified residue (102)
      • modified residue (126)
      • modified residue (251)
      • modified residue (318)
      • modified residue (364-365)
      • modified residue (377)
      • modified residue (403)
    Domains in SCOPe 2.07: d2fiqc_
  • Chain 'D':
    Compound: putative tagatose 6-phosphate kinase 1
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs2898
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37191 (0-419)
      • modified residue (0)
      • modified residue (58)
      • modified residue (102)
      • modified residue (126)
      • modified residue (251)
      • modified residue (318)
      • modified residue (364-365)
      • modified residue (377)
      • modified residue (403)
    Domains in SCOPe 2.07: d2fiqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fiqA (A:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvpggeas
    aiqsvhithvedaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqea
    qalaqwientrmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieq
    eliapenrsgclavieevmldepqywkkyyrtgfndslldiryslsdriryywphsrikn
    svetmmvnlqgvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiqA (A:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvvhithv
    edaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqeaqalaqwient
    rmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieqeliapenrsg
    clavieevmldepqywkkyyrtgfndslldiryslsdriryywphsriknsvetmmvnlq
    gvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fiqB (B:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvpggeas
    aiqsvhithvedaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqea
    qalaqwientrmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieq
    eliapenrsgclavieevmldepqywkkyyrtgfndslldiryslsdriryywphsrikn
    svetmmvnlqgvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiqB (B:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvhithve
    daantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqeaqalaqwientr
    mvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieqeliapenrsgc
    lavieevmldepqywkkyyrtgfndslldiryslsdriryywphsriknsvetmmvnlqg
    vdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygca
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fiqC (C:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvpggeas
    aiqsvhithvedaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqea
    qalaqwientrmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieq
    eliapenrsgclavieevmldepqywkkyyrtgfndslldiryslsdriryywphsrikn
    svetmmvnlqgvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiqC (C:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvpvhith
    vedaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqeaqalaqwien
    trmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieqeliapenrs
    gclavieevmldepqywkkyyrtgfndslldiryslsdriryywphsriknsvetmmvnl
    qgvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygca
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fiqD (D:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvpggeas
    aiqsvhithvedaantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqea
    qalaqwientrmvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieq
    eliapenrsgclavieevmldepqywkkyyrtgfndslldiryslsdriryywphsrikn
    svetmmvnlqgvdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiqD (D:)
    mktliarhkagehigicsvcsahplvieaalafdrnstrkvlieatsnqvnqfggytgmt
    padfrefvfaiadkvgfareriilggdhlgpncwqqenvdaameksvelvkayvragfsk
    ihldasmscagdpiplapetvaeraavlcfaaesvatdcqreqlsyvigtevpvhithve
    daantlrthqkafiargltealtrviaivvqpgvefdhsniihyqpqeaqalaqwientr
    mvyeahstdyqtrtaywelvrdhfailkvgpaltfalreaifalaqieqeliapenrsgc
    lavieevmldepqywkkyyrtgfndslldiryslsdriryywphsriknsvetmmvnlqg
    vdiplgmisqylpkqferiqsgelsaiphqlimdkiydvlrayrygcae