Lineage for d2fika2 (2fik A:8-185)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856285Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
    Class I MHC-related
  7. 856301Species Mouse (Mus musculus) [TaxId:10090] [54457] (7 PDB entries)
  8. 856302Domain d2fika2: 2fik A:8-185 [133525]
    Other proteins in same PDB: d2fika1, d2fikb1
    automatically matched to d1cd1a2
    complexed with gsl, nag, plm

Details for d2fika2

PDB Entry: 2fik (more details), 1.8 Å

PDB Description: structure of a microbial glycosphingolipid bound to mouse cd1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOP Domain Sequences for d2fika2:

Sequence, based on SEQRES records: (download)

>d2fika2 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d2fika2 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkypieiqlsagcemypgnasesflhvafqgkyvvrfwgtswq
tvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOP Domain Coordinates for d2fika2:

Click to download the PDB-style file with coordinates for d2fika2.
(The format of our PDB-style files is described here.)

Timeline for d2fika2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fika1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fikb1