SCOPe 2.08: Domain d2fika1: 2fik A:186-279

Lineage for d2fika1 (2fik A:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2fika1: 2fik A:186-279 [133524]
   Other proteins in same PDB: d2fika2, d2fikb_
   automated match to d3gmla2
   complexed with gsl, nag, plm

Details for d2fika1

PDB Entry: 2fik, 1.8 Å

PDB Description: structure of a microbial glycosphingolipid bound to mouse cd1d

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2fika1:

Sequence; same for both SEQRES and ATOM records:

>d2fika1 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Timeline for d2fika1:

• d2fika1 first appeared in SCOP 1.73
  
• d2fika1 appears in SCOPe 2.07