![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d2fika1: 2fik A:186-279 [133524] Other proteins in same PDB: d2fika2, d2fikb_ automated match to d3gmla2 complexed with gsl, nag, plm |
PDB Entry: 2fik (more details), 1.8 Å
SCOPe Domain Sequences for d2fika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fika1 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d2fika1: