Lineage for d2fh3c3 (2fh3 C:629-741)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665024Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1665025Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1665042Species Human (Homo sapiens) [TaxId:9606] [55761] (31 PDB entries)
    Uniprot P20065 55-179
  8. 1665098Domain d2fh3c3: 2fh3 C:629-741 [133467]
    automated match to d1p8xa3
    complexed with ca

Details for d2fh3c3

PDB Entry: 2fh3 (more details), 2.87 Å

PDB Description: c-terminal half of gelsolin soaked in low calcium at ph 8
PDB Compounds: (C:) gelsolin

SCOPe Domain Sequences for d2fh3c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh3c3 d.109.1.1 (C:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw

SCOPe Domain Coordinates for d2fh3c3:

Click to download the PDB-style file with coordinates for d2fh3c3.
(The format of our PDB-style files is described here.)

Timeline for d2fh3c3: