| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
| Protein Gelsolin [55759] (2 species) consists of six similar domains |
| Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries) Uniprot P20065 55-179 |
| Domain d2fh2c3: 2fh2 C:629-741 [133458] automated match to d1p8xa3 complexed with ca |
PDB Entry: 2fh2 (more details), 2.5 Å
SCOPe Domain Sequences for d2fh2c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh2c3 d.109.1.1 (C:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw
Timeline for d2fh2c3: