Lineage for d1p8xa3 (1p8x A:629-741)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. Domain d1p8xa3: 1p8x A:629-741 [94367]
    domains 4, 5 and 6
    complexed with ca

Details for d1p8xa3

PDB Entry: 1p8x (more details), 2 Å

PDB Description: The Calcium-Activated C-terminal half of gelsolin
PDB Compounds: (A:) Gelsolin precursor, plasma

SCOPe Domain Sequences for d1p8xa3:

Sequence, based on SEQRES records: (download)

>d1p8xa3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw

Sequence, based on observed residues (ATOM records): (download)

>d1p8xa3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmhpprlfacevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsa
kryietdnrdrrtpitvvkqgfeppsfvgwflgwdddyw

SCOPe Domain Coordinates for d1p8xa3 are not available.

Timeline for d1p8xa3:

Domains from same chain:
(mouse over for more information)
d1p8xa1, d1p8xa2
Domains from other chains:
(mouse over for more information)
d1p8xb1, d1p8xb2, d1p8xb3, d1p8xc1, d1p8xc2, d1p8xc3