Lineage for d2fh2c2 (2fh2 C:533-628)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731406Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 731407Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 731408Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 731409Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 731426Species Human (Homo sapiens) [TaxId:9606] [55761] (24 PDB entries)
  8. 731467Domain d2fh2c2: 2fh2 C:533-628 [133457]
    automatically matched to d1h1vg2
    complexed with ca

Details for d2fh2c2

PDB Entry: 2fh2 (more details), 2.5 Å

PDB Description: c-terminal half of gelsolin soaked in egta at ph 4.5
PDB Compounds: (C:) gelsolin

SCOP Domain Sequences for d2fh2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh2c2 d.109.1.1 (C:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOP Domain Coordinates for d2fh2c2:

Click to download the PDB-style file with coordinates for d2fh2c2.
(The format of our PDB-style files is described here.)

Timeline for d2fh2c2: