| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.109: Gelsolin-like [55752] (2 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (4 proteins) |
| Protein Gelsolin [55759] (2 species) consists of six similar domains |
| Species Human (Homo sapiens) [TaxId:9606] [55761] (24 PDB entries) |
| Domain d2fh2c2: 2fh2 C:533-628 [133457] automatically matched to d1h1vg2 complexed with ca |
PDB Entry: 2fh2 (more details), 2.5 Å
SCOP Domain Sequences for d2fh2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh2c2 d.109.1.1 (C:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp
Timeline for d2fh2c2: