Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries) Uniprot P20065 55-179 |
Domain d2fh1c3: 2fh1 C:629-741 [133449] automated match to d1p8xa3 complexed with ca |
PDB Entry: 2fh1 (more details), 1.55 Å
SCOPe Domain Sequences for d2fh1c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh1c3 d.109.1.1 (C:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw
Timeline for d2fh1c3: