Lineage for d2fh1a2 (2fh1 A:533-628)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665024Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1665025Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1665042Species Human (Homo sapiens) [TaxId:9606] [55761] (31 PDB entries)
    Uniprot P20065 55-179
  8. 1665045Domain d2fh1a2: 2fh1 A:533-628 [133442]
    automated match to d1p8xa2
    complexed with ca

Details for d2fh1a2

PDB Entry: 2fh1 (more details), 1.55 Å

PDB Description: c-terminal half of gelsolin soaked in low calcium at ph 4.5
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d2fh1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOPe Domain Coordinates for d2fh1a2:

Click to download the PDB-style file with coordinates for d2fh1a2.
(The format of our PDB-style files is described here.)

Timeline for d2fh1a2: