SCOPe 2.08: Domain d2fgga1: 2fgg A:4-87

Lineage for d2fgga1 (2fgg A:4-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.5: Rv2632c-like [143212] (1 family)
   lacks the N-terminal helix; dimerises via the N-terminal strand and the C-terminal helix with the formation of a single beta-sheet wrapped around an antiparallel coiled coil
   automatically mapped to Pfam PF08962

5. Family d.50.5.1: Rv2632c-like [143213] (1 protein)

6. Protein Hypothetical protein Rv2632c/MT2708 [143214] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143215] (1 PDB entry)
   Uniprot P65033 4-87

8. Domain d2fgga1: 2fgg A:4-87 [133438]

Details for d2fgga1

PDB Entry: 2fgg, 2.3 Å

PDB Description: Crystal Structure of Rv2632c

PDB Compounds: (A:) Hypothetical protein Rv2632c/MT2708

SCOPe Domain Sequences for d2fgga1:

Sequence; same for both SEQRES and ATOM records:

>d2fgga1 d.50.5.1 (A:4-87) Hypothetical protein Rv2632c/MT2708 {Mycobacterium tuberculosis [TaxId: 1773]}
sehvgktcqidvlieehdertrakarlswagrqmvgvglarldpadepvaqigdelaiar
alsdlanqlfaltssdieasthqp

Timeline for d2fgga1:

• d2fgga1 first appeared in SCOP 1.73
  
• d2fgga1 appears in SCOPe 2.07