Lineage for d2fgga1 (2fgg A:4-87)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722625Superfamily d.50.5: Rv2632c-like [143212] (1 family) (S)
    lacks the N-terminal helix; dimerises via the N-terminal strand and the C-terminal helix with the formation of a single beta-sheet wrapped around an antiparallel coiled coil
  5. 722626Family d.50.5.1: Rv2632c-like [143213] (1 protein)
  6. 722627Protein Hypothetical protein Rv2632c/MT2708 [143214] (1 species)
  7. 722628Species Mycobacterium tuberculosis [TaxId:1773] [143215] (1 PDB entry)
  8. 722629Domain d2fgga1: 2fgg A:4-87 [133438]

Details for d2fgga1

PDB Entry: 2fgg (more details), 2.3 Å

PDB Description: Crystal Structure of Rv2632c
PDB Compounds: (A:) Hypothetical protein Rv2632c/MT2708

SCOP Domain Sequences for d2fgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgga1 d.50.5.1 (A:4-87) Hypothetical protein Rv2632c/MT2708 {Mycobacterium tuberculosis [TaxId: 1773]}
sehvgktcqidvlieehdertrakarlswagrqmvgvglarldpadepvaqigdelaiar
alsdlanqlfaltssdieasthqp

SCOP Domain Coordinates for d2fgga1:

Click to download the PDB-style file with coordinates for d2fgga1.
(The format of our PDB-style files is described here.)

Timeline for d2fgga1: