SCOPe 2.08: Domain d2ffya_: 2ffy A:

Lineage for d2ffya_ (2ffy A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)

8. Domain d2ffya_: 2ffy A: [133394]
   automated match to d1c3ba_
   complexed with k, po4, sm3; mutant

Details for d2ffya_

PDB Entry: 2ffy, 1.07 Å

PDB Description: ampc beta-lactamase n289a mutant in complex with a boronic acid deacylation transition state analog compound sm3

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2ffya_:

Sequence; same for both SEQRES and ATOM records:

>d2ffya_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d2ffya_:

• d2ffya_ first appeared in SCOP 1.73, called d2ffya1
  
• d2ffya_ appears in SCOPe 2.07