SCOPe 2.05: Domain d2ffma_: 2ffm A:

Lineage for d2ffma_ (2ffm A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543

4. Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (2 families)
   automatically mapped to Pfam PF08712

5. Family d.267.1.1: Hypothetical protein SAV1430 [110837] (2 proteins)

6. Protein automated matches [190288] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [187092] (1 PDB entry)

8. Domain d2ffma_: 2ffm A: [133389]
   automated match to d1pqxa_

Details for d2ffma_

PDB Entry: 2ffm, 2.51 Å

PDB Description: x-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18.

PDB Compounds: (A:) sav1430

SCOPe Domain Sequences for d2ffma_:

Sequence; same for both SEQRES and ATOM records:

>d2ffma_ d.267.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfe

Timeline for d2ffma_:

• d2ffma_ first appeared in SCOP 1.73, called d2ffma1
  
• d2ffma_ appears in SCOPe 2.04
  
• d2ffma_ appears in SCOPe 2.06
  
• d2ffma_ appears in the current release, SCOPe 2.08