Lineage for d2ffma_ (2ffm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009257Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543
  4. 3009258Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (2 families) (S)
    automatically mapped to Pfam PF08712
  5. 3009259Family d.267.1.1: Hypothetical protein SAV1430 [110837] (2 proteins)
  6. 3009265Protein automated matches [190288] (1 species)
    not a true protein
  7. 3009266Species Staphylococcus aureus [TaxId:158878] [187092] (1 PDB entry)
  8. 3009267Domain d2ffma_: 2ffm A: [133389]
    automated match to d1pqxa_

Details for d2ffma_

PDB Entry: 2ffm (more details), 2.51 Å

PDB Description: x-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18.
PDB Compounds: (A:) sav1430

SCOPe Domain Sequences for d2ffma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffma_ d.267.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfe

SCOPe Domain Coordinates for d2ffma_:

Click to download the PDB-style file with coordinates for d2ffma_.
(The format of our PDB-style files is described here.)

Timeline for d2ffma_: