Lineage for d2ff6g_ (2ff6 G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665024Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1665144Protein automated matches [226883] (2 species)
    not a true protein
  7. 1665145Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries)
  8. 1665147Domain d2ff6g_: 2ff6 G: [133376]
    Other proteins in same PDB: d2ff6a1, d2ff6a2
    automated match to d3cipg_
    complexed with atp, ca

Details for d2ff6g_

PDB Entry: 2ff6 (more details), 2.05 Å

PDB Description: crystal structure of gelsolin domain 1:ciboulot domain 2 hybrid in complex with actin
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d2ff6g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ff6g_ d.109.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhv

SCOPe Domain Coordinates for d2ff6g_:

Click to download the PDB-style file with coordinates for d2ff6g_.
(The format of our PDB-style files is described here.)

Timeline for d2ff6g_: