![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
![]() | Protein automated matches [226883] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries) |
![]() | Domain d2ff6g_: 2ff6 G: [133376] Other proteins in same PDB: d2ff6a1, d2ff6a2 automated match to d3cipg_ complexed with atp, ca |
PDB Entry: 2ff6 (more details), 2.05 Å
SCOPe Domain Sequences for d2ff6g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff6g_ d.109.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas gfkhv
Timeline for d2ff6g_: