|  | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)  duplication contains two domains of this fold | 
|  | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) | 
|  | Protein Actin [53073] (7 species) | 
|  | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries) Uniprot P02568 ! SQ 02568 | 
|  | Domain d2ff6a2: 2ff6 A:147-375 [133375] Other proteins in same PDB: d2ff6g_ automated match to d1qz5a2 complexed with atp, ca | 
PDB Entry: 2ff6 (more details), 2.05 Å
SCOPe Domain Sequences for d2ff6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff6a2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
Timeline for d2ff6a2: