Lineage for d1qz5a2 (1qz5 A:147-375)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (7 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries)
Uniprot P02568 ! SQ 02568
Domain d1qz5a2: 1qz5 A:147-375 [96615]
complexed with atp, ca, kab
Details for d1qz5a2
PDB Entry: 1qz5 (more details), 1.45 Å
PDB Description: Structure of rabbit actin in complex with kabiramide C
PDB Compounds: (A:) Actin, alpha skeletal muscleSCOPe Domain Sequences for d1qz5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qz5a2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
SCOPe Domain Coordinates for d1qz5a2:
Click to download the PDB-style file with coordinates for d1qz5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qz5a2:
- d1qz5a2 first appeared in SCOP 1.67
- d1qz5a2 appears in SCOPe 2.02
- d1qz5a2 appears in SCOPe 2.04
- d1qz5a2 appears in the current release, SCOPe 2.08
View in 3D
