SCOPe 2.04: Domain d2ff3a_: 2ff3 A:

Lineage for d2ff3a_ (2ff3 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein automated matches [226883] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries)

8. Domain d2ff3a_: 2ff3 A: [133364]
   Other proteins in same PDB: d2ff3b1, d2ff3b2
   automated match to d3cipg_
   complexed with atp, ca

Details for d2ff3a_

PDB Entry: 2ff3, 2 Å

PDB Description: Crystal structure of Gelsolin domain 1:N-wasp V2 motif hybrid in complex with actin

PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d2ff3a_:

Sequence; same for both SEQRES and ATOM records:

>d2ff3a_ d.109.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhv

Timeline for d2ff3a_:

• d2ff3a_ first appeared in SCOP 1.73, called d2ff3a1
  
• d2ff3a_ appears in SCOPe 2.03
  
• d2ff3a_ appears in SCOPe 2.05
  
• d2ff3a_ appears in the current release, SCOPe 2.08