Lineage for d2fera_ (2fer A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450-CAM [48266] (1 species)
  7. Species Pseudomonas putida [TaxId:303] [48267] (121 PDB entries)
    Uniprot P00183
  8. Domain d2fera_: 2fer A: [133350]
    automated match to d1akd__
    complexed with k, mnr

Details for d2fera_

PDB Entry: 2fer (more details), 1.7000000000000002 Å

PDB Description: p450cam from pseudomonas putida reconstituted with manganic protoporphyrin ix
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d2fera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fera_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2fera_ are not available.

Timeline for d2fera_: